HPA000522

antibody from Atlas Antibodies

Targeting: RENBP RBP, RNBP

Antibody data

Submit

Validation data

Product number: HPA000522 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA000522, RRID:AB_1079798
Product name: Anti-RENBP
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: DMEKERETLQAWKERVGQELDRVVAFWMEHSHDQE HGGFFTCLGREGRVYDDLKYVWLQGRQVWMYCRLY RTFERFRHAQLLDAAKAGGEFLLRYARVAPPGKKC AFVLTRDGRPVKVQRTIFSE
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

RENBP protein structure - HPA000522 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human spleen and liver tissues using Anti-RENBP antibody. Corresponding RENBP RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, colon, kidney and lymph node using Anti-RENBP antibody HPA000522 (A) shows similar protein distribution across tissues to independent antibody HPA000428 (B).
Antibody #2 product nr: HPA000428
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows strong nuclear and cytoplasmic positivity in tubular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human spleen shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-RENBP antibody HPA000522.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-RENBP antibody HPA000522.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-RENBP antibody HPA000522.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-RENBP antibody HPA000522.
Sample type: HUMAN