Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00081876-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00081876-M02, RRID:AB_1112616
- Product name
- RAB1B monoclonal antibody (M02), clone 1B2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant RAB1B.
- Antigen sequence
TDQESYANVKQWLQEIDRYASENVNKLLVGNKSDL
TTKKVVDNTTAKEFADSLGIPFLETSAKNATNVEQ
AFMTMAAEIKKRMGPGAASGGERPNLKIDSTPVKP
AGGGCC- Isotype
- IgG
- Antibody clone number
- 1B2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- RAB1B monoclonal antibody (M02), clone 1B2. Western Blot analysis of RAB1B expression in A-431 ( Cat # L015V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of RAB1B expression in transfected 293T cell line by RAB1B monoclonal antibody (M02), clone 1B2.Lane 1: RAB1B transfected lysate(22.2 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged RAB1B is 0.03 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to RAB1B on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
