Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA000285 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA000285, RRID:AB_1079619
- Product name
- Anti-PIM2
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
SGALLHDEPYTDFDGTRVYSPPEWISRHQYHALPA
TVWSLGILLYDMVCGDIPFERDQEILEAELHFPAH
VSPDCCALIRRCLAPKPSSRPSLEEILLDPWMQTP
AEDVPLNPSKGGPAPLAWSL- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references PIM kinases are progression markers and emerging therapeutic targets in diffuse large B-cell lymphoma.
Pim-selective inhibitor DHPCC-9 reveals Pim kinases as potent stimulators of cancer cell migration and invasion.
Brault L, Menter T, Obermann EC, Knapp S, Thommen S, Schwaller J, Tzankov A
British journal of cancer 2012 Jul 24;107(3):491-500
British journal of cancer 2012 Jul 24;107(3):491-500
Pim-selective inhibitor DHPCC-9 reveals Pim kinases as potent stimulators of cancer cell migration and invasion.
Santio NM, Vahakoski RL, Rainio EM, Sandholm JA, Virtanen SS, Prudhomme M, Anizon F, Moreau P, Koskinen PJ
Molecular cancer 2010 Oct 19;9:279
Molecular cancer 2010 Oct 19;9:279
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows cytoplasmic positivity in cells in seminiferus ducts.