AV100812

NR2C1 antibody from Sigma-Aldrich
TR2, TR2-11
No application information provided.

Antibody data

Product number
AV100812
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV100812, RRID:AB_1854616
Product name
Anti-NR2C1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV100812
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human NR2C1 with an internal ID of P01895
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
AIVLFSPDHPSLENMEQIEKFQEKAYVEFQDYITK
TYPDDTYRLSRLLLR
Storage
-20C
Provider Type Product Number
- No reagents -