Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA000166 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA000166, RRID:AB_1078669
- Product name
- Anti-DKC1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
EAGTYIRTLCVHLGLLLGVGGQMQELRRVRSGVMS
EKDHMVTMHDVLDAQWLYDNHKDESYLRRVVYPLE
KLLTSHKRLVMKDSAVNAICYGAKIMLPGVLRYED
GIEVNQEIVVIT- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells.
Molecular markers implicating early malignant events in cervical carcinogenesis.
DKC1 overexpression associated with prostate cancer progression.
Relationship between dyskerin expression and telomerase activity in human breast cancer.
Stadler C, Rexhepaj E, Singan VR, Murphy RF, Pepperkok R, Uhlén M, Simpson JC, Lundberg E
Nature methods 2013 Apr;10(4):315-23
Nature methods 2013 Apr;10(4):315-23
Molecular markers implicating early malignant events in cervical carcinogenesis.
Koskimaa HM, Kurvinen K, Costa S, Syrjänen K, Syrjänen S
Cancer epidemiology, biomarkers & prevention : a publication of the American Association for Cancer Research, cosponsored by the American Society of Preventive Oncology 2010 Aug;19(8):2003-12
Cancer epidemiology, biomarkers & prevention : a publication of the American Association for Cancer Research, cosponsored by the American Society of Preventive Oncology 2010 Aug;19(8):2003-12
DKC1 overexpression associated with prostate cancer progression.
Sieron P, Hader C, Hatina J, Engers R, Wlazlinski A, Müller M, Schulz WA
British journal of cancer 2009 Oct 20;101(8):1410-6
British journal of cancer 2009 Oct 20;101(8):1410-6
Relationship between dyskerin expression and telomerase activity in human breast cancer.
Montanaro L, Calienni M, Ceccarelli C, Santini D, Taffurelli M, Pileri S, Treré D, Derenzini M
Cellular oncology : the official journal of the International Society for Cellular Oncology 2008;30(6):483-90
Cellular oncology : the official journal of the International Society for Cellular Oncology 2008;30(6):483-90
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 18Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human cell line A-431Lane 5: Human liver tissueLane 6: Human tonsil tissue
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows strong nucleolar positivity in neuronal cells.
- Sample type
- HUMAN
