HPA029143
antibody from Atlas Antibodies
Targeting: LTN1
C21orf10, C21orf98, FLJ11053, KIAA0714, LISTERIN, RNF160, ZNF294
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [5]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA029143 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA029143, RRID:AB_10671360
- Product name
- Anti-LTN1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
LMGVYIGSVMPNDSEWEKMRQSLPMQWLHRPLLEG
RLSLNYECFKTDFKEQDIKTLPSHLCTSALLSKMV
LIALRKETVL- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references RNA- and Antibody-Based Profiling of the Human Proteome with Focus on Chromosome 19
Stadler C, Fagerberg L, Sivertsson Å, Oksvold P, Zwahlen M, Hallström B, Lundberg E, Uhlén M
Journal of Proteome Research 2014 April;13(4):2019-2027
Journal of Proteome Research 2014 April;13(4):2019-2027
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human breast shows strong cytoplasmic positivity in glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows weak cytoplasmic positivity in cells in tubules.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lymph node shows no cytoplasmic positivity in non-germinal center cells as expected.
- Sample type
- HUMAN