HPA045680

SLC25A37 antibody from Atlas Antibodies
HT015, MFRN, MFRN1, MSCP
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA045680
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA045680, RRID:AB_10963693
Product name
Anti-SLC25A37
Provider product page
Atlas Antibodies - HPA045680
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ARRMDGDSRDGGGGKDATGSEDYENLPTSASV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -