Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004116-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004116-M02, RRID:AB_534915
- Product name
- MAGOH monoclonal antibody (M02), clone 4H8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant MAGOH.
- Antigen sequence
MESDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYA
NNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEIT
KEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIG
SLIDV- Isotype
- IgG
- Antibody clone number
- 4H8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- MAGOH monoclonal antibody (M02), clone 4H8 Western Blot analysis of MAGOH expression in Hela S3 NE ( Cat # L013V3 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of MAGOH expression in transfected 293T cell line by MAGOH monoclonal antibody (M02), clone 4H8.Lane 1: MAGOH transfected lysate(17.2 KDa).Lane 2: Non-transfected lysate.