HPA044659

CD47 antibody from Atlas Antibodies
IAP, MER6, OA3
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA044659
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA044659, RRID:AB_2679040
Product name
Anti-CD47
Provider product page
Atlas Antibodies - HPA044659
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
AQLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTT
EVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIE
VSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTRE
GETIIELKYRVVS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -