Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN406730 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Spermatogenesis Associated 22 (SPATA22) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SPATA22 antibody: synthetic peptide directed towards the N terminal of human SPATA22
- Reactivity
- Human, Mouse, Rat, Bovine, Porcine
- Host
- Rabbit
- Antigen sequence
MKRSLSENSARSTAGCLPVPLFNQKKRNRQPLTSN
PLKDD SGISTPSDNY- Vial size
- 50 µg
Submitted references Novel development-related alternative splices in human testis identified by cDNA microarrays.
[Nitrite content of common vegetables in Wuhu City].
Huang X, Li J, Lu L, Xu M, Xiao J, Yin L, Zhu H, Zhou Z, Sha J
Journal of andrology 2005 Mar-Apr;26(2):189-96
Journal of andrology 2005 Mar-Apr;26(2):189-96
[Nitrite content of common vegetables in Wuhu City].
Wang Y, Huang W, Liu D
Ying yong sheng tai xue bao = The journal of applied ecology / Zhongguo sheng tai xue xue hui, Zhongguo ke xue yuan Shenyang ying yong sheng tai yan jiu suo zhu ban 2005 Jan;16(1):189-92
Ying yong sheng tai xue bao = The journal of applied ecology / Zhongguo sheng tai xue xue hui, Zhongguo ke xue yuan Shenyang ying yong sheng tai yan jiu suo zhu ban 2005 Jan;16(1):189-92
No comments: Submit comment
No validations: Submit validation data