Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB29471 - Provider product page
- Provider
- Abnova Corporation
- Product name
- CGNL1 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant human CGNL1.
- Antigen sequence
NEKVEENSTLQQRLEESEGELRKNLEELFQVKMER
EQHQTEIRDLQDQLSEMHDELDSAKRSEDREKGAL
IEELLQAKQDLQDLLIAK- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western blot analysis of Lane 1: Human cell line RT-4 Lane 2: Human cell line U-251MG with CGNL1 polyclonal antibody (Cat # PAB29471) at 1:250-1:500 dilution.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-251 MG with CGNL1 polyclonal antibody (Cat # PAB29471) at 1-4 ug/mL concentration shows positivity in the Golgi apparatus and nucleus but excluded from the nucleoli.
- Validation comment
- Immunofluorescence
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney with CGNL1 polyclonal antibody (Cat # PAB29471) shows strong luminal membranous positivity in renal tubules at 1:1000-1:2500 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)