Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA000886 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA000886, RRID:AB_1079269
- Product name
- Anti-FRMD7
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
QVPRWSPIRAEERTSPHSYVEPTAMKPAERSPRNI
RMKSFQQDLQVLQEAIARTSGRSNINVGLEEEDPN
LEDAFVCNIQEQTPKRSQSQSDMKTIRFPFGSEFR
PLGPCPALSHKADLFTDMFAEQELPAVLMDQSTAE
RYVASESSDS- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references A novel interaction between FRMD7 and CASK: evidence for a causal role in idiopathic infantile nystagmus.
Expression and localization of FRMD7 in human fetal brain, and a role for F-actin.
The nystagmus-associated FRMD7 gene regulates neuronal outgrowth and development
Watkins RJ, Patil R, Goult BT, Thomas MG, Gottlob I, Shackleton S
Human molecular genetics 2013 May 15;22(10):2105-18
Human molecular genetics 2013 May 15;22(10):2105-18
Expression and localization of FRMD7 in human fetal brain, and a role for F-actin.
Pu J, Li Y, Liu Z, Yan Y, Tian J, Chen S, Zhang B
Molecular vision 2011 Feb 24;17:591-7
Molecular vision 2011 Feb 24;17:591-7
The nystagmus-associated FRMD7 gene regulates neuronal outgrowth and development
Betts-Henderson J, Bartesaghi S, Crosier M, Lindsay S, Chen H, Salomoni P, Gottlob I, Nicotera P
Human Molecular Genetics 2009 December;19(2):342-351
Human Molecular Genetics 2009 December;19(2):342-351
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN