Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [7]
- Comments [0]
- Validations
- Western blot [2]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005764-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005764-M01, RRID:AB_464137
- Product name
- PTN monoclonal antibody (M01), clone 5C3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PTN.
- Antigen sequence
SDCGEWQWSVCVPTSGDCGLGTREGTRTGAECKQT
MKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTA
LKTRTGSLKRALHNAECQKTVTISKPCGKLTKPKP
QAESK- Isotype
- IgG
- Antibody clone number
- 5C3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Expression of the growth factor pleiotrophin and its receptor protein tyrosine phosphatase beta/zeta in the serum, cartilage and subchondral bone of patients with osteoarthritis.
Interplay between αvβ3 integrin and nucleolin regulates human endothelial and glioma cell migration.
Implications of pleiotrophin in human PC3 prostate cancer cell growth in vivo.
Pleiotrophin promotes microglia proliferation and secretion of neurotrophic factors by activating extracellular signal-regulated kinase 1/2 pathway.
A peptide corresponding to the C-terminal region of pleiotrophin inhibits angiogenesis in vivo and in vitro.
Integrin alpha(v)beta(3) is a pleiotrophin receptor required for pleiotrophin-induced endothelial cell migration through receptor protein tyrosine phosphatase beta/zeta.
Aprotinin stimulates angiogenesis and human endothelial cell migration through the growth factor pleiotrophin and its receptor protein tyrosine phosphatase beta/zeta.
Kaspiris A, Mikelis C, Heroult M, Khaldi L, Grivas TB, Kouvaras I, Dangas S, Vasiliadis E, Lioté F, Courty J, Papadimitriou E
Joint, bone, spine : revue du rhumatisme 2013 Jul;80(4):407-13
Joint, bone, spine : revue du rhumatisme 2013 Jul;80(4):407-13
Interplay between αvβ3 integrin and nucleolin regulates human endothelial and glioma cell migration.
Koutsioumpa M, Polytarchou C, Courty J, Zhang Y, Kieffer N, Mikelis C, Skandalis SS, Hellman U, Iliopoulos D, Papadimitriou E
The Journal of biological chemistry 2013 Jan 4;288(1):343-54
The Journal of biological chemistry 2013 Jan 4;288(1):343-54
Implications of pleiotrophin in human PC3 prostate cancer cell growth in vivo.
Tsirmoula S, Dimas K, Hatziapostolou M, Lamprou M, Ravazoula P, Papadimitriou E
Cancer science 2012 Oct;103(10):1826-32
Cancer science 2012 Oct;103(10):1826-32
Pleiotrophin promotes microglia proliferation and secretion of neurotrophic factors by activating extracellular signal-regulated kinase 1/2 pathway.
Miao J, Ding M, Zhang A, Xiao Z, Qi W, Luo N, Di W, Tao Y, Fang Y
Neuroscience research 2012 Dec;74(3-4):269-76
Neuroscience research 2012 Dec;74(3-4):269-76
A peptide corresponding to the C-terminal region of pleiotrophin inhibits angiogenesis in vivo and in vitro.
Mikelis C, Lamprou M, Koutsioumpa M, Koutsioubas AG, Spyranti Z, Zompra AA, Spiliopoulos N, Vradis AA, Katsoris P, Spyroulias GA, Cordopatis P, Courty J, Papadimitriou E
Journal of cellular biochemistry 2011 Jun;112(6):1532-43
Journal of cellular biochemistry 2011 Jun;112(6):1532-43
Integrin alpha(v)beta(3) is a pleiotrophin receptor required for pleiotrophin-induced endothelial cell migration through receptor protein tyrosine phosphatase beta/zeta.
Mikelis C, Sfaelou E, Koutsioumpa M, Kieffer N, Papadimitriou E
FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2009 May;23(5):1459-69
FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2009 May;23(5):1459-69
Aprotinin stimulates angiogenesis and human endothelial cell migration through the growth factor pleiotrophin and its receptor protein tyrosine phosphatase beta/zeta.
Koutsioumpa M, Hatziapostolou M, Mikelis C, Koolwijk P, Papadimitriou E
European journal of pharmacology 2009 Jan 14;602(2-3):245-9
European journal of pharmacology 2009 Jan 14;602(2-3):245-9
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- PTN monoclonal antibody (M01), clone 5C3 Western Blot analysis of PTN expression in Hela S3 NE ( Cat # L013V3 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of PTN expression in transfected 293T cell line by PTN monoclonal antibody (M01), clone 5C3.Lane 1: PTN transfected lysate(18.9 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to PTN on formalin-fixed paraffin-embedded human cerebral cortex. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
