AV53597

INHA antibody from MilliporeSigma / Merck KGaA
No application information provided.

Antibody data

Product number
AV53597
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#AV53597, RRID:AB_1851787
Product name
Anti-INHA antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - AV53597
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human INHA with an internal ID of P30916
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EGLFRYMFRPSQHTRSRQVTSAQLWFHTGLDRQGT
AASNSSEPLLGLLAL
Storage
-20C
Provider Type Product Number
- No reagents -