HPA051776

RADIL antibody from Atlas Antibodies
FLJ10324, KIAA1849, RASIP2

Antibody data

Product number
HPA051776
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA051776, RRID:AB_2681605
Product name
Anti-RADIL
Provider product page
Atlas Antibodies - HPA051776
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
YGTHFIMSPPTKSKLKRQSQLLSSMLSRTLSYKYR
DLDSTFSSLGASDDPAELSTQLSAPGVLKVFGDSV
CTGTHYKSVLA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.