Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00374659-M05 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00374659-M05, RRID:AB_10627700
- Product name
- HDDC3 monoclonal antibody (M05), clone 7E6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full-length recombinant HDDC3.
- Antigen sequence
MGSEAAQLLEAADFAARKHRQQRRKDPEGTPYINH
PIGVARILTHEAGITDIVVLQAALLHDTVEDTDTT
LDEVELHFGAQVRRLVEEVTDDKTLPKLERKRLQV
EQAPHSSPGAKLVKLADKLYNLRDLNRCTPEVKIQ- Isotype
- IgG
- Antibody clone number
- 7E6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- HDDC3 monoclonal antibody (M05), clone 7E6. Western Blot analysis of HDDC3 expression in MCF-7(Cat # L046V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of HDDC3 expression in transfected 293T cell line by HDDC3 monoclonal antibody (M05), clone 7E6.Lane 1: HDDC3 transfected lysate (Predicted MW: 15.7 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged HDDC3 is 0.3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol