HPA043810

CRPPA antibody from Atlas Antibodies
hCG_1745121, ISPD, Nip
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA043810
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA043810, RRID:AB_10964489
Product name
Anti-ISPD
Provider product page
Atlas Antibodies - HPA043810
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SELNHVKVTSEALGHAGRHLQQIILDQCYNFVCVN
VTTSDFQETQKLLSMLEESSLCILYPVVVVSVHFL
DFKLVPPSQKMENLMQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -