ABIN786004

CRPPA antibody from antibodies-online
hCG_1745121, ISPD, Nip

Antibody data

Product number
ABIN786004
Provider
antibodies-online
Product name
anti-Isoprenoid Synthase Domain Containing (ISPD) (N-Term) antibody
Provider product page
antibodies-online - ABIN786004
Antibody type
Polyclonal
Antigen
The immunogen for anti-hCG_1745121 antibody: synthetic peptide directed towards the N terminal of human hCG_1745121
Reactivity
Human
Host
Rabbit
Antigen sequence
MTPQSLLQTTLFLLSLLFLVQGAHGRGHREDFRFC
SQRNQ THRSSLHYKP
Vial size
50 µg
Provider Type Product Number
- No reagents -