HPA030654

antibody from Atlas Antibodies

Targeting: ZNF711 CMPX1, dJ75N13.1, MRX65, MRX97, Zfp711, ZNF4, ZNF5, ZNF6

Antibody data

Submit

Validation data

Product number: HPA030654 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA030654, RRID:AB_10670561
Product name: Anti-ZNF711
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: DVVTDDGITLDHGLAAEVVHGPDIITETDVVTEGV IVPEAVLEADVAIEEDLEEDDGDHILTSELITETV RVPEQVFVADLVTGPNGHLEHVVQDCVSGVDSPTM VSEEVLVTN
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

ZNF711 protein structure - HPA030654 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human cerebral cortex and liver tissues using HPA030654 antibody. Corresponding ZNF711 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows moderate to strong nuclear positivity in neurons.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebellum shows moderate to strong nuclear positivity in Purkinje cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.
Sample type: HUMAN