H00007852-M05
antibody from Abnova Corporation
Targeting: CXCR4
CD184, D2S201E, fusin, HM89, HSY3RR, LESTR, NPY3R, NPYR, NPYY3R
Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007852-M05 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007852-M05, RRID:AB_606116
- Product name
- CXCR4 monoclonal antibody (M05), clone 2F1
- Antibody type
- Monoclonal
- Antigen
- CXCR4 (AAH20968, 1 a.a. ~ 46 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Reactivity
- Human
- Host
- Mouse
- Antigen sequence
MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENAN
FNKIFLPTIYS- Isotype
- IgG
- Vial size
- 50 µg
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references CXCR4 is highly expressed at the tumor front but not in the center of prostate cancers.
CXCR7 expression is associated with disease-free and disease-specific survival in cervical cancer patients.
Delongchamps NB, Beuvon F, Mathieu JR, Delmas S, Metzger I, Prats H, Cabon F
World journal of urology 2015 Feb;33(2):281-7
World journal of urology 2015 Feb;33(2):281-7
CXCR7 expression is associated with disease-free and disease-specific survival in cervical cancer patients.
Schrevel M, Karim R, ter Haar NT, van der Burg SH, Trimbos JB, Fleuren GJ, Gorter A, Jordanova ES
British journal of cancer 2012 Apr 24;106(9):1520-5
British journal of cancer 2012 Apr 24;106(9):1520-5
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged CXCR4 is 0.03 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to CXCR4 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol