Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502216 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Statherin (STATH) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-STATH antibody: synthetic peptide directed towards the middle region of human STATH
- Description
- Affinity Purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
MKFLVFAFILALMVSMIGADSSEEKFLRRIGRFGY
GYGPY QPVPEQPLYP- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Quantitative proteomic analysis of gingival crevicular fluid in different periodontal conditions.
The Oxygen Tension in the Submaxillary Glands and certain other tissues.
Silva-Boghossian CM, Colombo AP, Tanaka M, Rayo C, Xiao Y, Siqueira WL
PloS one 2013;8(10):e75898
PloS one 2013;8(10):e75898
The Oxygen Tension in the Submaxillary Glands and certain other tissues.
Barcroft JL
The Biochemical journal 1906;1(1):1-10
The Biochemical journal 1906;1(1):1-10
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting