HPA044016

antibody from Atlas Antibodies

Targeting: CABS1 C4orf35, CLPH, FLJ32897, NYD-SP26

Antibody data

Submit

Validation data

Product number: HPA044016 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA044016, RRID:AB_10964494
Product name: Anti-CABS1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: GTTNSITRDSITEHFMPVKIGNISSPVTTVSLIDF STDIAKEDILLATIDTGDAEISITSEVSGTLKDSS AGVADAPAFPRKKDEADMSNYNSSIKSNVP
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

CABS1 protein structure - HPA044016 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human testis and fallopian tube tissues using Anti-CABS1 antibody. Corresponding CABS1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human kidney, liver, lymph node and testis using Anti-CABS1 antibody HPA044016 (A) shows similar protein distribution across tissues to independent antibody HPA055352 (B).
Antibody #2 product nr: HPA055352
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows strong cytoplasmic positivity in late spermatids.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human fallopian tube shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-CABS1 antibody HPA044016.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-CABS1 antibody HPA044016.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-CABS1 antibody HPA044016.
Sample type: HUMAN