Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003399-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003399-M02, RRID:AB_733185
- Product name
- ID3 monoclonal antibody (M02), clone 3E10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ID3.
- Antigen sequence
MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAE
EPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEIL
QRVIDYILDLQVV- Isotype
- IgG
- Antibody clone number
- 3E10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Increased expression of Id1 and Id3 promotes tumorigenicity by enhancing angiogenesis and suppressing apoptosis in small cell lung cancer.
Increased expression of Id1 and Id3 promotes tumorigenicity by enhancing angiogenesis and suppressing apoptosis in small cell lung cancer.
Chen D, Forootan SS, Gosney JR, Forootan FS, Ke Y
Genes & cancer 2014 May;5(5-6):212-25
Genes & cancer 2014 May;5(5-6):212-25
Increased expression of Id1 and Id3 promotes tumorigenicity by enhancing angiogenesis and suppressing apoptosis in small cell lung cancer.
Chen D, Forootan SS, Gosney JR, Forootan FS, Ke Y
Genes & cancer 2014 May;5(5-6):212-25
Genes & cancer 2014 May;5(5-6):212-25
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged ID3 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to ID3 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol