HPA005830

antibody from Atlas Antibodies

Targeting: L1CAM CD171, HSAS, HSAS1, MASA, MIC5, S10, SPG1

Antibody data

Submit

Validation data

Product number: HPA005830 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA005830, RRID:AB_1079219
Product name: Anti-L1CAM
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: ELRTHNLTDLSPHLRYRFQLQATTKEGPGEAIVRE GGTMALSGISDFGNISATAGENYSVVSWVPKEGQC NFRFHILFKALGEEKGGASLSPQYVSYNQSSYTQW DLQPDTDYEIHLFKERMFRHQMAVKTNGTGRVRLP PAGFATE
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

L1CAM protein structure - HPA005830 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human cerebral cortex and skeletal muscle tissues using HPA005830 antibody. Corresponding L1CAM RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity in neuropil.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows moderate membranous positivity in cells in distal tubules.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon shows moderate positivity in peripheral nerve / ganglion.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.
Sample type: HUMAN