HPA047185

antibody from Atlas Antibodies

Targeting: PIEZO1 FAM38A, KIAA0233

Antibody data

Submit

Validation data

Product number: HPA047185 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA047185, RRID:AB_2679973
Product name: Anti-PIEZO1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: SVVGVVNQPIDVTVTLKLGGYEPLFTMSAQQPSII PFTAQAYEELSRQFDPQPLAMQFISQYSPEDIVTA QIEGSSGALWRISPPSRAQMKRELYNGTADITLRF TWNFQRDLAKGGTVEYANEKH
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

PIEZO1 protein structure - HPA047185 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human lung and skeletal muscle tissues using HPA047185 antibody. Corresponding PIEZO1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows distinct positivity in neuropil.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lung shows moderate positivity in pneumocytes.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lung shows positivity in erythrocytes.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity in neuropil.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected.
Sample type: HUMAN