H00002305-M01
antibody from Abnova Corporation
Targeting: FOXM1
FKHL16, HFH-11, HNF-3, INS-1, MPHOSPH2, MPP2, TGT3, trident
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002305-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002305-M01, RRID:AB_489862
- Product name
- FOXM1 monoclonal antibody (M01), clone 3A9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant FOXM1.
- Antigen sequence
LQSAPPLESPQRLLSSEPLDLISVPFGNSSPSDID
VPKPGSPEPQVSGLAANRSLTEGLVLDTMNDSLSK
ILLDISFPGLDEDPLGPDNINWSQFIPELQ- Isotype
- IgG
- Antibody clone number
- 3A9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of FOXM1 expression in transfected 293T cell line by FOXM1 monoclonal antibody (M01), clone 3A9.Lane 1: FOXM1 transfected lysate(84 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged FOXM1 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol