Antibody data

Product number
HPA064535
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA064535, RRID:AB_2685280
Product name
Anti-CDK5
Provider product page
Atlas Antibodies - HPA064535
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNA
TGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -