Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
- Proximity ligation assay [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005601-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005601-M02, RRID:AB_463959
- Product name
- MAPK9 monoclonal antibody (M02), clone 2F8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant MAPK9.
- Antigen sequence
ITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKEL
IYKEVMDWEERSKNGVVKDQPSDAAVSSNATPSQS
SSINDISSMSTEQTLASDTDSSLDASTGPLEGCR- Isotype
- IgG
- Antibody clone number
- 2F8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- MAPK9 monoclonal antibody (M02), clone 2F8 Western Blot analysis of MAPK9 expression in HeLa ( Cat # L013V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged MAPK9 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to MAPK9 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between TRAF2 and MAPK9. HeLa cells were stained with anti-TRAF2 rabbit purified polyclonal 1:1200 and anti-MAPK9 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)
