HPA001906

antibody from Atlas Antibodies

Targeting: ATRX JMS, MRX52, RAD54, XH2, XNP

Western blot (Enhanced validation)

Immunocytochemistry (Supportive data in Antibodypedia)

Immunohistochemistry (Enhanced validation)

Antibody Data

Product number

HPA001906

Provider

Atlas Antibodies

Proper citation

Atlas Antibodies Cat#HPA001906, RRID:AB_1078249

Product name

Anti-ATRX

Antibody type

Polyclonal

Reactivity

Human

Host

Rabbit

Conjugate

Unconjugated

Antigen sequence

AAWAEYEAEKKGLTMRFNIPTGTNLPPVSFNSQTP
YIPFNLGALSAMSNQQLEDLINQGREKVVEATNSV
TAVRIQPLEDIISAVWKENMNLSEAQVQALALSRQ
ASQELDVKRREAIYNDVLTKQQMLISCVQRILMNR
R


Isotype

IgG

Vial size

100 µl

Storage

Store at +4°C for short term storage. Long time storage is recommended at -20°C.

References

Submitted references

TERT promoter mutations are frequent and show association with MED12 mutations in phyllodes tumors of the breast.

Yoshida M, Ogawa R, Yoshida H, Maeshima A, Kanai Y, Kinoshita T, Hiraoka N, Sekine S
British journal of cancer 2015 Oct 20;113(8):1244-8

---

ATRX represses alternative lengthening of telomeres.

Napier CE, Huschtscha LI, Harvey A, Bower K, Noble JR, Hendrickson EA, Reddel RR
Oncotarget 2015 Jun 30;6(18):16543-58

---

Molecular-genetic and clinical characteristics of gliomas with astrocytic appearance and total 1p19q loss in a single institutional consecutive cohort.

Hayashi S, Sasaki H, Kimura T, Abe T, Nakamura T, Kitamura Y, Miwa T, Kameyama K, Hirose Y, Yoshida K
Oncotarget 2015 Jun 30;6(18):15871-81

---

Whole-exome sequencing identifies somatic ATRX mutations in pheochromocytomas and paragangliomas

Fishbein L, Khare S, Wubbenhorst B, DeSloover D, D’Andrea K, Merrill S, Cho N, Greenberg R, Else T, Montone K, LiVolsi V, Fraker D, Daber R, Cohen D, Nathanson K
Nature Communications 2015 January;6

---

Clinical multiplexed exome sequencing distinguishes adult oligodendroglial neoplasms from astrocytic and mixed lineage gliomas

Cryan J, Haidar S, Ramkissoon L, Linda Bi W, Knoff D, Schultz N, Abedalthagafi M, Brown L, Wen P, Reardon D, Dunn I, Folkerth R, Santagata S, Lindeman N, Ligon A, Beroukhim R, Hornick J, Alexander B, Ligon K, Ramkissoon S
Oncotarget 2014 October;5(18):8083-8092

---

Benefit From Procarbazine, Lomustine, and Vincristine in Oligodendroglial Tumors Is Associated With Mutation of IDH

Cairncross J, Wang M, Jenkins R, Shaw E, Giannini C, Brachman D, Buckner J, Fink K, Souhami L, Laperriere N, Huse J, Mehta M, Curran W
Journal of Clinical Oncology 2014 March;32(8):783-790

---

Telomerase inhibition abolishes the tumorigenicity of pediatric ependymoma tumor-initiating cells

Barszczyk M, Buczkowicz P, Castelo-Branco P, Mack S, Ramaswamy V, Mangerel J, Agnihotri S, Remke M, Golbourn B, Pajovic S, Elizabeth C, Yu M, Luu B, Morrison A, Adamski J, Nethery-Brokx K, Li X, Van Meter T, Dirks P, Rutka J, Taylor M, Tabori U, Hawkins C
Acta Neuropathologica 2014 December;128(6):863-877

---

Clinical Neuropathology practice news 2-2014: ATRX, a new candidate biomarker in gliomas

Haberler C, Wöhrer A
Clinical Neuropathology 2014 ;33(03):108-111

---

Molecular and Morphologic Correlates of the Alternative Lengthening of Telomeres Phenotype in High-Grade Astrocytomas

Nguyen D, Heaphy C, de Wilde R, Orr B, Odia Y, Eberhart C, Meeker A, Rodriguez F
Brain Pathology 2013 May;23(3):237-243

---

The alternative lengthening of telomere phenotype is significantly associated with loss of ATRX expression in high-grade pediatric and adult astrocytomas: a multi-institutional study of 214 astrocytomas

Abedalthagafi M, Phillips J, Kim G, Mueller S, Haas-Kogen D, Marshall R, Croul S, Santi M, Cheng J, Zhou S, Sullivan L, Martinez-Lage M, Judkins A, Perry A
Modern Pathology 2013 June;26(11):1425-1432

---

Loss of ATRX or DAXX expression and concomitant acquisition of the alternative lengthening of telomeres phenotype are late events in a small subset of MEN-1 syndrome pancreatic neuroendocrine tumors

de Wilde R, Heaphy C, Maitra A, Meeker A, Edil B, Wolfgang C, Ellison T, Schulick R, Molenaar I, Valk G, Vriens M, Borel Rinkes I, Offerhaus G, Hruban R, Matsukuma K
Modern Pathology 2012 May;25(7):1033-1039

---

Loss of ATRX, Genome Instability, and an Altered DNA Damage Response Are Hallmarks of the Alternative Lengthening of Telomeres Pathway

Lovejoy C, Li W, Reisenweber S, Thongthip S, Bruno J, de Lange T, De S, Petrini J, Sung P, Jasin M, Rosenbluh J, Zwang Y, Weir B, Hatton C, Ivanova E, Macconaill L, Hanna M, Hahn W, Lue N, Reddel R, Jiao Y, Kinzler K, Vogelstein B, Papadopoulos N, Meeker A, Scott H
PLoS Genetics 2012 July;8(7)

---

Frequent ATRX, CIC, FUBP1 and IDH1 mutations refine the classification of malignant gliomas

Jiao Y, Killela P, Reitman Z, Rasheed B, Heaphy C, de Wilde R, Rodriguez F, Rosemberg S, Obashinjo S, Nagahashi Marie S, Bettegowda C, Agrawal N, Lipp E, Pirozzi C, Lopez G, He Y, Friedman H, Friedman A, Riggins G, Holdhoff M, Burger P, McLendon R, Bigner D, Vogelstein B, Meeker A, Kinzler K, Papadopoulos N, Diaz, Jr. L, Yan H
Oncotarget 2012 July;3(7):709-722

---

Driver mutations in histone H3.3 and chromatin remodelling genes in paediatric glioblastoma

Schwartzentruber J, Korshunov A, Liu X, Jones D, Pfaff E, Jacob K, Sturm D, Fontebasso A, Quang D, Tönjes M, Hovestadt V, Albrecht S, Kool M, Nantel A, Konermann C, Lindroth A, Jäger N, Rausch T, Ryzhova M, Korbel J, Hielscher T, Hauser P, Garami M, Klekner A, Bognar L, Ebinger M, Schuhmann M, Scheurlen W, Pekrun A, Frühwald M, Roggendorf W, Kramm C, Dürken M, Atkinson J, Lepage P, Montpetit A, Zakrzewska M, Zakrzewski K, Liberski P, Dong Z, Siegel P, Kulozik A, Zapatka M, Guha A, Malkin D, Felsberg J, Reifenberger G, von Deimling A, Ichimura K, Collins V, Witt H, Milde T, Witt O, Zhang C, Castelo-Branco P, Lichter P, Faury D, Tabori U, Plass C, Majewski J, Pfister S, Jabado N
Nature 2012 January;482(7384):226-231

---

Altered Telomeres in Tumors with ATRX and DAXX Mutations

Heaphy C, de Wilde R, Jiao Y, Klein A, Edil B, Shi C, Bettegowda C, Rodriguez F, Eberhart C, Hebbar S, Offerhaus G, McLendon R, Rasheed B, He Y, Yan H, Bigner D, Oba-Shinjo S, Marie S, Riggins G, Kinzler K, Vogelstein B, Hruban R, Maitra A, Papadopoulos N, Meeker A
Science 2011 July;333(6041):425-425

Western blot

Enhanced validation

Submitted by

Atlas Antibodies (provider)

Enhanced method

Genetic validation

Main image

Experimental details

Western blot analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-ATRX antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Immunocytochemistry

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunofluorescent staining of human cell line A549 shows localization to nucleoplasm and nuclear bodies.

Sample type

HUMAN

Immunohistochemistry

Enhanced validation

Submitted by

Atlas Antibodies (provider)

Enhanced method

Orthogonal validation

Main image

Experimental details

Immunohistochemistry analysis in human cerebral cortex and liver tissues using HPA001906 antibody. Corresponding ATRX RNA-seq data are presented for the same tissues.

Sample type

HUMAN

Orthogonal method

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Show more

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human glioma shows moderate to strong nuclear positivity in tumor cells.

Sample type

HUMAN

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human cerebral cortex shows moderate nuclear positivity in neurons and glial cells.

Sample type

HUMAN

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human fallopian tube shows moderate to strong nuclear positivity in glandular cells.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in a subset of cells in seminiferous ducts and Leydig cells.

Sample type

HUMAN

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Staining of human liver shows no positivity in hepatocytes as expected.

Sample type

HUMAN

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human uterine cervix shows moderate to strong nuclear positivity in squamous epithelial cells.

Sample type

HUMAN