Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN503108 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Lens Intrinsic Membrane Protein 2, 19kDa (LIM2) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-LIM2 antibody: synthetic peptide directed towards the N terminal of human LIM2
- Description
- Affinity Purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
GSFAHQGLWRYCLGNKCYLQTDSIGEPPGQGPGRA
WGKSR ADLGAQGHLY- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Expressed sequence tag analysis of adult human lens for the NEIBank Project: over 2000 non-redundant transcripts, novel genes and splice variants.
Differential interaction of molecular chaperones with procollagen I and type IV collagen in corneal endothelial cells.
Wistow G, Bernstein SL, Wyatt MK, Behal A, Touchman JW, Bouffard G, Smith D, Peterson K
Molecular vision 2002 Jun 15;8:171-84
Molecular vision 2002 Jun 15;8:171-84
Differential interaction of molecular chaperones with procollagen I and type IV collagen in corneal endothelial cells.
Ko MK, Kay EP
Molecular vision 2002 Jan 11;8:1-9
Molecular vision 2002 Jan 11;8:1-9
No comments: Submit comment
No validations: Submit validation data