PAB24543
antibody from Abnova Corporation
Targeting: ZC3HAV1
ARTD13, FLB6421, FLJ13288, MGC48898, PARP13, ZAP, ZC3H2, ZC3HDC2
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB24543 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#PAB24543, RRID:AB_11126129
- Product name
- ZC3HAV1 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant ZC3HAV1.
- Antigen sequence
NGKSGTQDIQPGPLFNNNADGVATDITSTRSLNYK
STSSGHREISSPRIQDAGPASRDVQATGRIADDAD
PRVALVNDSLSDVTSTTSSRVDDHDSEEICLDHL- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western blot analysis of ZC3HAV1 polyclonal antibody (Cat # PAB24543).Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: human plasma, Lane 4: liver, Lane 5: tonsil.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-251 MG shows positivity in plasma membrane, cytoplasm & golgi apparatus.Using ZC3HAV1 polyclonal antibody (Cat # PAB24543).
- Validation comment
- Immunofluorescence
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis with ZC3HAV1 polyclonal antibody (Cat # PAB24543) shows strong cytoplasmic positivity in cells in seminiferus ducts at 1:20-1:50 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)