Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00055922-M06 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00055922-M06, RRID:AB_1204732
- Product name
- NKRF monoclonal antibody (M06), clone 1F6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant NKRF.
- Antigen sequence
LGLDVERVNKIAKRDIEQIIRNYARSESHTDLTFS
RELTNDERKQIHQIAQKYGLKSKSHGVGHDRYLVV
GRKRRKEDLLDQLKQEGQVGHYELVMPQAN- Isotype
- IgG
- Antibody clone number
- 1F6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of NKRF expression in transfected 293T cell line by NKRF monoclonal antibody (M06), clone 1F6.Lane 1: NKRF transfected lysate(77.7 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged NKRF is 0.1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol