Explore
Validate
LearnPAB15701
antibody from Abnova Corporation
Targeting: ERC2
CAST, CAST1, ELKSL, KIAA0378, SPBC110, Spc110
Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB15701 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#PAB15701, RRID:AB_10678360
- Product name
- Erc2 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against partial recombinant mouse Erc2.
- Antigen sequence
LMNALEKTRQELDATKARLASTQQSLAEKEAHLAN
LRIERRKQLEEILEMKQEALLAAISEKDANIALLE
LSASKKKKTQEEVMALKREKDRLVHQLKQQTQNRM
KLMADNYDEDHHHYHHHHHHHHHRSPGRSQHSNHR
PSPDQDDEEGIWA- Storage
- Store at -20°C.Aliquot to avoid repeated freezing and thawing.
Submitted references Physical and functional interaction of the active zone proteins, CAST, RIM1, and Bassoon, in neurotransmitter release.
A comprehensive approach for establishment of the platform to analyze functions of KIAA proteins II: public release of inaugural version of InGaP database containing gene/protein expression profiles for 127 mouse KIAA genes/proteins.
High-throughput production of recombinant antigens for mouse KIAA proteins in Escherichia coli: computational allocation of possible antigenic regions, and construction of expression plasmids of glutathione-S-transferase-fused antigens by an in vitro recombination-assisted method.
Takao-Rikitsu E, Mochida S, Inoue E, Deguchi-Tawarada M, Inoue M, Ohtsuka T, Takai Y
The Journal of cell biology 2004 Jan 19;164(2):301-11
The Journal of cell biology 2004 Jan 19;164(2):301-11
A comprehensive approach for establishment of the platform to analyze functions of KIAA proteins II: public release of inaugural version of InGaP database containing gene/protein expression profiles for 127 mouse KIAA genes/proteins.
Koga H, Yuasa S, Nagase T, Shimada K, Nagano M, Imai K, Ohara R, Nakajima D, Murakami M, Kawai M, Miki F, Magae J, Inamoto S, Okazaki N, Ohara O
DNA research : an international journal for rapid publication of reports on genes and genomes 2004 Aug 31;11(4):293-304
DNA research : an international journal for rapid publication of reports on genes and genomes 2004 Aug 31;11(4):293-304
High-throughput production of recombinant antigens for mouse KIAA proteins in Escherichia coli: computational allocation of possible antigenic regions, and construction of expression plasmids of glutathione-S-transferase-fused antigens by an in vitro recombination-assisted method.
Hara Y, Shimada K, Kohga H, Ohara O, Koga H
DNA research : an international journal for rapid publication of reports on genes and genomes 2003 Jun 30;10(3):129-36
DNA research : an international journal for rapid publication of reports on genes and genomes 2003 Jun 30;10(3):129-36
No comments: Submit comment
No validations: Submit validation data