Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN635243 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Low Density Lipoprotein Receptor Class A Domain Containing 1 (LDLRAD1) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- LDLRAD1 antibody was raised using the middle region of LDLRAD1 corresponding to a region with amino acids DEDESLCRDVPQSLPHFLVAHCGDPASWIYSDQKCDGTNNCGDCSDELSP
- Description
- Affinity purified
- Reactivity
- Human
- Host
- Rabbit
- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1 mg/mL
- Storage
- Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
- Handling
- Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.
Submitted references A chimeric LDL receptor containing the cytoplasmic domain of the transferrin receptor is degraded by PCSK9.
Holla ØL, Strøm TB, Cameron J, Berge KE, Leren TP
Molecular genetics and metabolism 2010 Feb;99(2):149-56
Molecular genetics and metabolism 2010 Feb;99(2):149-56
No comments: Submit comment
No validations: Submit validation data