H00008852-M02

AKAP4 antibody from Abnova Corporation
AKAP82, CT99, Fsc1, hAKAP82, HI, p82

Antibody data

Product number
H00008852-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00008852-M02, RRID:AB_535106
Product name
AKAP4 monoclonal antibody (M02), clone 4C10
Provider product page
Abnova Corporation - H00008852-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant AKAP4.
Antigen sequence
MMAYSDTTMMSDDIDWLRSHRGVCKVDLYNPEGQQ
DQDRKVICFVDVSTLNVEDKDYKDAASSSSEGNLN
LGSLEEKEIIVIKDTEKKDQSKTEGSVCLF
Isotype
IgG
Antibody clone number
4C10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -