HPA050029

antibody from Atlas Antibodies

Targeting: ADGRG2 EDDM6, GPR64, HE6, TM7LN2

Antibody data

Submit

Validation data

Product number: HPA050029 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA050029, RRID:AB_2680996
Product name: Anti-ADGRG2
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: NASGVKPQRNICNLSSICNDSAFFRGEIMFQYDKE STVPQNQHITNGTLTGVLSLSELKRSELNKTLQTL SETYFIMCATAEAQSTLNCTFTIKLNNTMNACAVI AALERVKIRPMEHCCCSVRIPCP
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

ADGRG2 protein structure - HPA050029 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human epididymis and endometrium tissues using Anti-ADGRG2 antibody. Corresponding ADGRG2 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human epididymis, liver, lymph node and testis using Anti-ADGRG2 antibody HPA050029 (A) shows similar protein distribution across tissues to independent antibody HPA001478 (B).
Antibody #2 product nr: HPA001478
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human epididymis shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human endometrium shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-ADGRG2 antibody HPA050029.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-ADGRG2 antibody HPA050029.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-ADGRG2 antibody HPA050029.
Sample type: HUMAN