R31795

antibody from NSJ Bioreagents

Targeting: SLC10A1 NTCP

Antibody data

Submit

Validation data

Product number: R31795 - Provider product page
Provider: NSJ Bioreagents
Product name: SLC10A1 Antibody / NTCP
Antibody type: Polyclonal
Antigen: Amino acids EGLLFIIIFRCYLKIKPQKDQTKITYKAAATEDATPAALEK of mouse SLC10A1/NTCP were used as the immunogen for the NTCP antibody.
Description: Antigen affinity
Reactivity: Human, Mouse, Rat
Host: Rabbit
Conjugate: Unconjugated
Vial size: 100 µg
Concentration: Lyophilized; resuspend with 200 ul for 0.5 mg/ml
Storage: After reconstitution, the NTCP antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

SLC10A1 protein structure - R31795 shown in red.

Supportive validation

Submitted by: NSJ Bioreagents (provider)
Main image
Experimental details: IHC testing of FFPE human liver cancer tissue with NTCP antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.

Supportive validation

Submitted by: NSJ Bioreagents (provider)
Main image
Experimental details: IHC testing of FFPE mouse liver with NTCP antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.

Supportive validation

Submitted by: NSJ Bioreagents (provider)
Main image
Experimental details: IHC testing of FFPE rat liver with NTCP antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.

Supportive validation

Submitted by: NSJ Bioreagents (provider)
Main image
Experimental details: IHC testing of frozen mouse liver tissue with NTCP antibody.

Supportive validation

Submitted by: NSJ Bioreagents (provider)
Main image
Experimental details: Immunofluorescent staining of FFPE mouse liver with NTCP antibody (green) and DAPI nuclear counterstain (blue). HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.

Supportive validation

Submitted by: NSJ Bioreagents (provider)
Main image
Experimental details: Immunofluorescent staining of FFPE mouse liver with NTCP antibody (red) and DAPI nuclear counterstain (blue). HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.