Home > Search result > TTC7A > HPA036782

HPA036782

antibody from Atlas Antibodies

Targeting: TTC7A KIAA1140, TTC7

Provider product page for HPA036782

Immunohistochemistry

Antibody data

Antibody Data
Antigen structure
References [0]
Comments [0]
Validations
Immunohistochemistry [8]

Submit

Validation data

Product number: HPA036782 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA036782, RRID:AB_10671711
Product name: Anti-TTC7A
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: TSRHLKGCHPLDYELTYFLEAALQSAYVKNLKKGN IVKGMRELREVLRTVETKATQNFKVMAAKHLAGVL LHSLSEECYWSPLSHPLPEFMGKE
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

TTC7A protein structure - HPA036782 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human small intestine and skeletal muscle tissues using HPA036782 antibody. Corresponding TTC7A RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

: Show more

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human small intestine shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in Leydig cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human tonsil shows weak cytoplasmic positivity in non-germinal center cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in glandular cells.
Sample type: HUMAN