HPA001662

SCML2 antibody from MilliporeSigma / Merck KGaA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001662
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA001662, RRID:AB_1079879
Product name
Anti-SCML2 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA001662
Antibody type
Polyclonal
Antigen
Sex comb on midleg-like protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SSPSEASQHSMQSPQKTTLILPTQQVRRSSRIKPP
GPTAVPKRSSSVKNITPRKKGPNSGKKEKPLPVIC
STSAASLKSLTRDRGMLYKDVASGPCKIVMSTVCV
YVNKHGNFGPHLDPKRIQQLPDHFGPGPVNVV
Storage
-20C
Provider Type Product Number
- No reagents -