Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB28619 - Provider product page
- Provider
- Abnova Corporation
- Product name
- HCCS polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant HCCS.
- Antigen sequence
YVECPIRGTAAENKENLDPSNLMPPPNQTPAPDQP
FALSTVREESSIPRADSEKKWVYPSEQMFWNAMLK
KGWKWKDEDISQKDMYNIIRIHNQNNEQAWKEILK
WEALHAAECPCGPSLIRFGGKAKEYSPRARIRSWM
GYEL- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western blot analysis of Lane 1: Human cell line RT-4 with HCCS polyclonal antibody (Cat # PAB28619) at 1:100-1:25 dilution.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-251MG with HCCS polyclonal antibody (Cat # PAB28619) at 1-4 ug/ml shows positivity in mitochondria.
- Validation comment
- Immunofluorescence
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human parathyroid with HCCS polyclonal antibody (Cat # PAB28619) shows strong cytoplasmic positivity in glandular cells at 1:20-1:50 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)