PAB24519
antibody from Abnova Corporation
Targeting: C19orf12
DKFZP762D096, MGC10922, MPAN, NBIA4, SPG43
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB24519 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#PAB24519, RRID:AB_11122294
- Product name
- C19orf12 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant C19orf12.
- Antigen sequence
GAWMTSGQFKPVPQILMELPPAEQQRLFNEAAAII
RHLEWTDAVQLTALVMGSEALQQQLLAMLVNYVTK
ELRAEIQ- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human breast with C19orf12 polyclonal antibody (Cat # PAB24519) shows strong positivity in adipocytes at 1:50-1:200 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)