Antibody data

Product number
PAB23130
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB23130, RRID:AB_11120836
Product name
SR140 polyclonal antibody
Provider product page
Abnova Corporation - PAB23130
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant SR140.
Antigen sequence
EEELDGAPLEDVDGIPIDATPIDDLDGVPIKSLDD
DLDGVPLDATEDSKKNEPIFKVAPSKWEAVDESEL
EAQAVTTSKWEL
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -