HPA036441

antibody from Atlas Antibodies

Targeting: DMGDH

Antibody data

Submit

Validation data

Product number: HPA036441 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA036441, RRID:AB_2675124
Product name: Anti-DMGDH
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: IINVVNGPITYSPDILPMVGPHQGVRNYWVAIGFG YGIIHAGGVGKYLSDWILHGEPPFDLIELDPNRYG KWTTTQYTE
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

DMGDH protein structure - HPA036441 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human liver and lymph node tissues using Anti-DMGDH antibody. Corresponding DMGDH RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human colon, kidney, liver and lymph node using Anti-DMGDH antibody HPA036441 (A) shows similar protein distribution across tissues to independent antibody HPA036442 (B).
Antibody #2 product nr: HPA036442
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-DMGDH antibody HPA036441.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-DMGDH antibody HPA036441.
Sample type: HUMAN