HPA058203

antibody from Atlas Antibodies

Targeting: DNAH12 DHC3, DLP12, DNAH12L, DNAH7L, Dnahc3, DNHD2, FLJ40427, FLJ44290, hdhc3, HL-19

Antibody data

Submit

Validation data

Product number: HPA058203 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA058203, RRID:AB_2683637
Product name: Anti-DNAH12
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: LLCANLLLARKEIEYQELMFLLTGGVSLKSAEKNP DPTWLQDKSWEEICRASEFPAFRGLRQHFCEHIYE WREIYDSKEPHNAKFPAPMDKNLNELQKII
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

DNAH12 protein structure - HPA058203 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human fallopian tube and prostate tissues using Anti-DNAH12 antibody. Corresponding DNAH12 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, fallopian tube, liver and prostate using Anti-DNAH12 antibody HPA058203 (A) shows similar protein distribution across tissues to independent antibody HPA037493 (B).
Antibody #2 product nr: HPA037493
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human fallopian tube shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human prostate shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-DNAH12 antibody HPA058203.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-DNAH12 antibody HPA058203.
Sample type: HUMAN