PAB23049

ZNRF3 antibody from Abnova Corporation
BK747E2.3, FLJ22057, KIAA1133, RNF203

Antibody data

Product number
PAB23049
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB23049, RRID:AB_11123410
Product name
ZNRF3 polyclonal antibody
Provider product page
Abnova Corporation - PAB23049
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant ZNRF3.
Antigen sequence
PNSSTSEVGLEASPGAAPDLRRTWKGGHELPSCAC
CCEPQPSPAGPSAGAAGSSTLFLGPHLYEGSGPAG
GEPQSGSSQGLYGLHPDHLPRTDGVKYEGLPCCFY
EEKQVAR
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -