HPA003473

antibody from Atlas Antibodies

Targeting: PAGE1 CT16.3, GAGE-9, GAGEB1, PAGE-1

Antibody data

Submit

Validation data

Product number: HPA003473 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA003473, RRID:AB_1079558
Product name: Anti-PAGE1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: EESSDEQPDEVESPTQSQDSTPAEEREDEGASAAQ GQEPEADSQELVQPKTGCELGDGPDTKRVCLRNEE QMKLPAEGPEPEADSQEQVHPKTGCERGDGPDVQE LGLPNPEEVKTPEEDE
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

PAGE1 protein structure - HPA003473 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human testis and prostate tissues using HPA003473 antibody. Corresponding PAGE1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human prostate shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows no positivity in neurons as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human gastrointestinal shows no positivity in glandular cells as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human prostate shows no positivity in glandular cells as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.
Sample type: HUMAN