HPA039241

antibody from Atlas Antibodies

Targeting: ODF3 CT135, hSHIPPO, SHIPPO1

Antibody data

Submit

Validation data

Product number: HPA039241 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA039241, RRID:AB_10673417
Product name: Anti-ODF3
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: PGPKYLIPPTTGFMKHTPTKLRAPAYSFRGAPMLL AENCSPGPRYNVNPKILRTGKDLGPAYSILGRYQT KTMLTP
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

ODF3 protein structure - HPA039241 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human testis and endometrium tissues using Anti-ODF3 antibody. Corresponding ODF3 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, epididymis, lymph node and testis using Anti-ODF3 antibody HPA039241 (A) shows similar protein distribution across tissues to independent antibody HPA038919 (B).
Antibody #2 product nr: HPA038919
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in subsets of cells in seminiferus ducts(spermatids).

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human endometrium shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human epididymis using Anti-ODF3 antibody HPA039241.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-ODF3 antibody HPA039241.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-ODF3 antibody HPA039241.
Sample type: HUMAN