Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00027330-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00027330-M02, RRID:AB_509309
- Product name
- RPS6KA6 monoclonal antibody (M02), clone 6F2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant RPS6KA6.
- Antigen sequence
RIGNGKFSLSGGNWDNISDGAKDLLSHMLHMDPHQ
RYTAEQILKHSWITHRDQLPNDQPKRNDVSHVVKG
AMVATYSALTHKTFQPVLEPVAASSLAQRRSMKKR
TSTGL- Isotype
- IgG
- Antibody clone number
- 6F2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- RPS6KA6 monoclonal antibody (M02), clone 6F2 Western Blot analysis of RPS6KA6 expression in PC-12 ( Cat # L012V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to RPS6KA6 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol