Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB23245 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#PAB23245, RRID:AB_11121740
- Product name
- CREG2 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant CREG2.
- Antigen sequence
RCVQLTLTGQMIAVSPEEVEFAKQAMFSRHPGMRK
WPRQYEWFFMKMRIEHIWLQKWYGGASSISREEYF
KAVP- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human hippocampus with CREG2 polyclonal antibody (Cat # PAB23245) shows distinct staining in neurofilaments and moderate positivity in neurons at 1:20-1:50 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)