Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN504620 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Choroideremia (Rab Escort Protein 1) (CHM) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CHM antibody: synthetic peptide directed towards the N terminal of human CHM
- Description
- Affinity Purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
LHVDSRSYYGGNWASFSFSGLLSWLKEYQENSDIV
SDSPV WQDQILENEE- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Effect of a clinical pathway after laparoscopic surgery for colorectal cancer.
New type of mutations in three spanish families with choroideremia.
Ishiguro S, Yamamoto S, Fujita S, Akasu T, Kobayashi Y, Moriya Y
Hepato-gastroenterology 2008 Jul-Aug;55(85):1315-9
Hepato-gastroenterology 2008 Jul-Aug;55(85):1315-9
New type of mutations in three spanish families with choroideremia.
Garcia-Hoyos M, Lorda-Sanchez I, Gómez-Garre P, Villaverde C, Cantalapiedra D, Bustamante A, Diego-Alvarez D, Vallespin E, Gallego-Merlo J, Trujillo MJ, Ramos C, Ayuso C
Investigative ophthalmology & visual science 2008 Apr;49(4):1315-21
Investigative ophthalmology & visual science 2008 Apr;49(4):1315-21
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting